PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09900.1.p
Common NameBRADI_4g09900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 316aa    MW: 34206.8 Da    PI: 6.124
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161764148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd+ l + v+++G g+W++ ar  g++Rt+k+c++rw++yl
  Bradi4g09900.1.p 17 RGPWTVEEDLTLMNHVAEHGEGRWNAAARAAGLRRTGKSCRLRWLNYL 64
                      89********************************************97 PP

2Myb_DNA-binding49.21.2e-1570113146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg +++ E+++++d++ ++G++ W++Ia+ ++ gRt++++k++w++
  Bradi4g09900.1.p  70 RGDFSAHEQLRILDLHSRWGNR-WSKIAAQLP-GRTDNEIKNYWRT 113
                       899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.8041268IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-221367IPR009057Homeodomain-like
SMARTSM007171.2E-121666IPR001005SANT/Myb domain
SuperFamilySSF466894.87E-2916111IPR009057Homeodomain-like
PfamPF002492.8E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2368118IPR009057Homeodomain-like
PROSITE profilePS5129416.96969119IPR017930Myb domain
SMARTSM007173.1E-1369117IPR001005SANT/Myb domain
PfamPF002491.5E-1370113IPR001005SANT/Myb domain
CDDcd001673.58E-973113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MTSSMADHQE EGEVLRRGPW TVEEDLTLMN HVAEHGEGRW NAAARAAGLR RTGKSCRLRW  60
LNYLRPDVKR GDFSAHEQLR ILDLHSRWGN RWSKIAAQLP GRTDNEIKNY WRTRVQKHAK  120
QLNCDAGSKA FNDAMRYLWM PRLAERAAAA DIAASSCLHS NNNNSTTATS SGGGGLSPSV  180
VPGAGAGMSC LDHRQNTTGG ISPGAGSAVT TSCCRSTSST GSSSELSQEQ QQLLLHGGGG  240
GGESSWMMQE VDDHEFWAAH MQIQPEQFID VDQEISGWVQ GFSDMVADGG CGVSGSAAAG  300
EENSLWSLED IWKMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231511125120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7308990.0EU730899.1 Brachypodium distachyon clone BAC DH002G02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237394.20.0PREDICTED: transcription factor MYB108
TrEMBLI1IJB40.0I1IJB4_BRADI; Uncharacterized protein
STRINGBRADI4G09900.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-56myb domain protein 112